PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00040.303
Common NameAMTR_s00040p00235500, LOC18441501
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 247aa    MW: 27729 Da    PI: 6.1017
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00040.303genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-2051103456
                                               -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               ++++++eq+e Le++F+++ +++ e++ +LA +lgL  rqV vWFqNrRa++k
  evm_27.model.AmTr_v1.0_scaffold00040.303  51 KRRLSEEQIESLEKCFQEETKLQPERKMRLAGELGLHPRQVAVWFQNRRARWK 103
                                               4579************************************************9 PP

2HD-ZIP_I/II118.83e-3850141293
                               HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkray 70 
                                               +krrls+eq+++LE++F+ee+kL+perK++la eLgl+prqvavWFqnrRAR+k+kq+E+ y++Lk+++
  evm_27.model.AmTr_v1.0_scaffold00040.303  50 RKRRLSEEQIESLEKCFQEETKLQPERKMRLAGELGLHPRQVAVWFQNRRARWKSKQVEHLYHSLKHQF 118
                                               8******************************************************************** PP

                               HD-ZIP_I/II  71 dalkeenerLekeveeLreelke 93 
                                                 +++e+++L++ev +Lr+el+e
  evm_27.model.AmTr_v1.0_scaffold00040.303 119 HLVSKEKQKLHEEVLKLRAELRE 141
                                               *******************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.68E-1940106IPR009057Homeodomain-like
PROSITE profilePS5007116.95745105IPR001356Homeobox domain
SMARTSM003891.8E-1848109IPR001356Homeobox domain
CDDcd000861.79E-1850106No hitNo description
PfamPF000464.9E-1851103IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-2052112IPR009057Homeodomain-like
PRINTSPR000313.5E-57685IPR000047Helix-turn-helix motif
PROSITE patternPS00027080103IPR017970Homeobox, conserved site
PRINTSPR000313.5E-585101IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MMMPWNGNLL LPPYGGGGWS HSPSMAAVYN DGPGGGAMGA FLKQEGGTGR KRRLSEEQIE  60
SLEKCFQEET KLQPERKMRL AGELGLHPRQ VAVWFQNRRA RWKSKQVEHL YHSLKHQFHL  120
VSKEKQKLHE EVLKLRAELR ERERERGMTA REESGVVELS TVGGEESASA CVGNATTTNY  180
EDNGDEDDDT LMKCDCHPFS TINCRYGAGC SDDNNYLIPC LDDDGRPSQP NYYYNWDVGP  240
GCIKSL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197105RRARWKSKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851793.10.0PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR03e-36ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLW1Q0520.0W1Q052_AMBTC; Uncharacterized protein
STRINGPGSC0003DMT4000069496e-39(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.11e-31homeobox 51
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]
  2. Zhao JL, et al.
    Micro-trichome as a class I homeodomain-leucine zipper gene regulates multicellular trichome development in Cucumis sativus.
    J Integr Plant Biol, 2015. 57(11): p. 925-35
    [PMID:25735194]